Metadata-Version: 2.4
Name: thoipapy
Version: 3.2.0
Summary: Machine-learning prediction of residues driving homotypic transmembrane interactions.
Author-email: Bo Zeng <bojigu@users.noreply.github.com>, Mark Teese <teese@users.noreply.github.com>
Maintainer-email: Mark Teese <teese@users.noreply.github.com>
License-Expression: MIT
Project-URL: Homepage, https://github.com/bojigu/thoipapy
Project-URL: Issues, https://github.com/bojigu/thoipapy/issues
Project-URL: TU_Munich, https://www.tum.de
Project-URL: DataCatalysis, https://www.datacatalysis.com
Project-URL: LinkedIn, https://www.linkedin.com/in/markteese/
Keywords: bioinformatics,protein,transmembrane,residue,conservation,coevolution,covariance,evolutionary couplings,polarity,hydrophobicity,randomforest,machinelearning,interface,LIPS,evolution
Classifier: Programming Language :: Python :: 3.12
Classifier: Programming Language :: Python :: 3.13
Classifier: Intended Audience :: Science/Research
Classifier: Topic :: Scientific/Engineering :: Chemistry
Classifier: Topic :: Scientific/Engineering :: Physics
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
Requires-Python: >=3.12
Description-Content-Type: text/x-rst
License-File: license.txt
Requires-Dist: biopython==1.88
Requires-Dist: joblib==1.5.3
Requires-Dist: matplotlib==3.11.1
Requires-Dist: numpy==2.5.2
Requires-Dist: openpyxl==3.1.5
Requires-Dist: pandas==3.0.5
Requires-Dist: psutil==7.2.2
Requires-Dist: requests==2.34.2
Requires-Dist: scikit-learn==1.9.0
Requires-Dist: scipy==1.18.0
Requires-Dist: seaborn==0.13.2
Requires-Dist: weighslide==0.3.0
Requires-Dist: certifi==2026.7.22
Requires-Dist: charset-normalizer==3.5.1
Requires-Dist: contourpy==1.3.3
Requires-Dist: cycler==0.12.1
Requires-Dist: idna==3.19
Requires-Dist: urllib3==2.7.0
Requires-Dist: et-xmlfile==2.0.0
Requires-Dist: fonttools==4.63.0
Requires-Dist: kiwisolver==1.5.0
Requires-Dist: narwhals==2.24.0
Requires-Dist: packaging==26.3
Requires-Dist: pillow==12.3.0
Requires-Dist: pyparsing==3.3.2
Requires-Dist: python-dateutil==2.9.0.post0
Requires-Dist: six==1.17.0
Requires-Dist: threadpoolctl==3.6.0
Provides-Extra: test
Requires-Dist: pytest==9.1.1; extra == "test"
Dynamic: license-file

.. image:: https://raw.githubusercontent.com/bojigu/thoipapy/develop/thoipapy/docs/THOIPA_banner.png

THOIPApy
========

The Transmembrane HOmodimer Interface Prediction Algorithm (THOIPA) is a machine learning method for the analysis of protein-protein-interactions.

THOIPA predicts transmembrane homodimer interface residues from evolutionary sequence information.

THOIPA helps predict potential homotypic transmembrane interface residues, which can then be verified experimentally.
THOIPA also aids in the energy-based modelling of transmembrane homodimers.

Important links:

* `THOIPA webserver <http://www.thoipa.org>`_
* `THOIPA FAQ <https://github.com/bojigu/thoipapy/wiki/What-is-THOIPA%3F>`_
* `THOIPA wiki main page <https://github.com/bojigu/thoipapy/wiki/THOIPA-wiki-main-page>`_


How does thoipapy work?
-----------------------

* retrieves protein homologues from the ColabFold MSA server, or a local BLAST database
* extracts residue properties (e.g. residue conservation and polarity)
* trains a machine learning classifier
* validates the prediction performance
* creates heatmaps of residue properties and THOIPA prediction


Installation
------------

THOIPA is on PyPI, but read this before installing it.

.. code:: bash

    pip install "thoipapy>=3.0"

**Ask for 3.0 or newer.** Releases up to 1.2.0 were published between 2018 and 2021 and no longer
work: the model they ship is a scikit-learn 0.23 pickle, which no current scikit-learn can load,
so they install without error and then fail on the first prediction. 2.0.0 and 2.1.0 run, but they
pass the protein name to a shell and they score the wrong sequence with rate4site whenever that
name contains a hyphen; see the 3.0.0 entry in ``thoipapy/docs/releases.rst``.

**Install it into a new, empty environment.** Every dependency is pinned to an exact version
(``numpy==2.5.2``, ``pandas==3.0.5``, and so on), so pip will almost certainly refuse to install
it alongside packages you already have. That is intended, not a defect: THOIPA is not actively
maintained, and exact pins are what stop an unattended install from silently resolving to a
different numerical result years from now.

The same pinning means that on a future python, where those exact versions have no wheel, the
install will fail outright rather than succeed and misbehave. If that happens, use the conda
environment below, which also pins the interpreter.

.. code:: bash

    conda env create -f environment.yml
    conda activate thoipapy
    pip install -e .

This is the supported path, and the only one that pins python itself along with the external
command-line tools.

THOIPA has only been tested on Linux, because of its reliance on external programs such as
FreeContact, CD-HIT and rate4site.


Working on the code
-------------------

Install the git hooks once per clone. They are configured in the repository but do not run
until installed, so a fresh clone commits with no checks at all.

.. code:: bash

    pre-commit install

The hooks format and lint the code, and refuse a commit that adds a large file, an office
document, or a dataset or archive outside the test tree. None of them need an account or a
network connection, so this is all an outside contributor has to do.

**Secret scanning, strongly recommended for anyone with push access.** One more command,
once per clone:

.. code:: bash

    pre-commit install -c .pre-commit-config-ggshield.yaml --hook-type pre-push

Those are two different git hooks, ``.git/hooks/pre-commit`` and ``.git/hooks/pre-push``, so
they coexist. The second scans the commits being pushed and refuses the push if it finds a
credential, which is the last point before it becomes permanent and has to be rotated.

It needs a GitGuardian account, which is free for small teams. Create one, then either export
``GITGUARDIAN_API_KEY`` or run ``ggshield auth login`` once after ``pipx install ggshield``. It
is kept out of ``.pre-commit-config.yaml`` on purpose: ggshield fails loudly without an
account, so a hook there would break the first commit of anyone who clones the repository.

There is no secret-scanning step in CI on this repository, because that needs an API key
stored as a repository secret and no one on the project currently has the admin rights to add
one. The pre-push hook above is what covers it in the meantime.


Dependencies
------------

THOIPApy requires python 3.12 or newer and is tested on python 3.13.

**Every dependency is pinned to an exact version.** This is deliberate. THOIPA is scientific
software whose output has to stay reproducible, and a version range resolves to something
different every time it is installed. The failure that causes is not a helpful error at install
time; it is a prediction that quietly differs from the published one. Pinning trades the ability
to install alongside arbitrary other packages for the ability to still work in five years. Use a
dedicated environment.

Pins live in three places, which are kept in step:

=========================  ==================================================================
file                       pins
=========================  ==================================================================
``pyproject.toml``         python packages; what ``pip install .`` reads
``requirements.txt``       the same packages plus their transitive dependencies
``environment.yml``        the python interpreter and the external command-line tools
=========================  ==================================================================

The external tools are pinned for the same reason as the python packages: a different
``rate4site`` or ``cd-hit`` changes the conservation scores and the redundancy reduction, and
therefore the features and the prediction.

You are of course free to relax the pins and test a newer combination. Nothing guarantees that
it resolves, or that predictions still match. If you do, run the full test suite, including the
golden-file regression tests, before trusting the result.

Several pipeline steps call external command-line programs rather than python libraries.
``blast``, ``cd-hit`` and ``rate4site`` are installed by ``environment.yml``. ``freecontact`` is
not packaged for conda on any channel, so it is installed separately, either with root:

.. code:: bash

    sudo apt-get install freecontact

or without, into the active conda environment:

.. code:: bash

    ./scripts/install_freecontact.sh

Phobius is no longer required. It was needed only for the ``n_TMDs`` feature, which was removed
in 2.0.0. See ``docs/n_TMDs_dropped.md``.

Getting the data (training sets, models, test data)
---------------------------------------------------

**If you only want to run predictions, you do not need any of this.** The trained model ships
inside the package, so ``pip install thoipapy`` gives you a working predictor with no data
download, no clone, and no DVC. Everything below is for developers who want to retrain the model,
re-run the validation, or run the test suite.

The code lives in git; the data does not. ``data/`` is about 128 MB of training sets, homologue
alignments, extracted features and prediction outputs, which is too large and too binary to keep
in a git repository. It is stored separately and fetched with a tool called **DVC** (Data Version
Control).

**If you have not used DVC before**, the idea is simple. DVC leaves a small text file in git for
each data directory, for example ``data/features.dvc``. That file records a checksum, not the
data. When you run ``dvc pull``, DVC reads those checksums and downloads the matching files from
a data store into ``data/``. It is, in effect, ``git clone`` for large files. You do not need an
account, a login, or any credentials to fetch this project's data.

Full documentation: https://dvc.org/doc . A good short introduction is
https://dvc.org/doc/start/data-management/data-versioning .

Step 1: install DVC
~~~~~~~~~~~~~~~~~~~

If you created the conda environment from ``environment.yml`` you already have it, and can skip to
step 2. Otherwise, pick whichever you prefer::

    # with conda or mamba (recommended, matches environment.yml)
    conda install -c conda-forge dvc dvc-http

    # or with pip
    pip install "dvc[http]"

``dvc-http`` matters: this project's public data store is served over HTTPS, and plain ``dvc``
cannot read an HTTPS remote without it. If you see ``URL 'https://...' is supported but requires
these missing dependencies``, this is what is missing.

Check it worked::

    dvc --version

Step 2: fetch the data
~~~~~~~~~~~~~~~~~~~~~~

From the root of your clone::

    dvc pull -j 4

Expect roughly 3800 files, 128 MB, and a minute or two on a normal connection.

**Use** ``-j 4``. The ``-j`` flag sets how many files DVC downloads at once. Its default is four
times your CPU count, which is enough parallel requests that the data store starts refusing them,
and the pull fails with ``429 Too Many Requests``. ``-j 4`` avoids this. If you still see 429
errors, lower it further with ``-j 2``.

To confirm everything arrived::

    dvc status

``Data and pipelines are up to date.`` means the contents of ``data/`` match the checksums
recorded in git, so you have exactly the files the authors had.

Fetching only part of the data
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

The full set is rarely needed. To fetch one directory, name its ``.dvc`` file::

    dvc pull -j 4 test/regression_data.dvc  # run the test suite                    28 KB
    dvc pull -j 4 data/features.dvc         # retrain the model                      18 MB
    dvc pull -j 4 data/results.dvc          # trained models and validation output   25 MB
    dvc pull -j 4 data/homologues.dvc       # re-extract features from alignments    60 MB

The remaining directories are small: ``data/Proteins`` (420 KB), ``data/Input_data`` (272 KB) and
``data/ETRA_data`` (112 KB). ``data/Predictions`` (26 MB) holds the published predictions and is
needed only to compare against them.

Common problems
~~~~~~~~~~~~~~~

``429 Too Many Requests``
    Too many parallel downloads. Use ``dvc pull -j 4``, or ``-j 2`` on a fast connection.

``URL 'https://...' is supported but requires these missing dependencies``
    ``dvc-http`` is not installed. See step 1.

``No DVC remote is specified``
    You are not in the repository root, or ``.dvc/config`` is missing. Run ``dvc remote list``;
    it should print a remote named ``public``.

``dvc: command not found``
    DVC installed into a different environment than the one you have active. Run
    ``conda activate thoipapy`` first.

The pull is slow or stalls
    The data store is rate-limited. This is expected and ``-j 4`` handles it. DVC resumes where it
    stopped, so re-running ``dvc pull -j 4`` after an interruption is safe and will not re-download
    what you already have.

How old the alignments are, and what that means
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

**The DVC-tracked homologues were downloaded from NCBI nr in May 2020.** The modernisation updated
the code, not the data. Every alignment-derived feature in ``data/features/`` -- conservation,
rate4site, the PSSM columns, coevolution, LIPS, and the polarity features that read from the PSSM
-- descends from that download, and so does the shipped model.

The provenance is recorded per protein and can be checked:

.. code:: bash

    tar -xzOf data/homologues/xml/crystal/1orqC4.surr20.BLAST.xml.tar.gz --wildcards '*details*'
    # acc  1orqC4
    # download_date  20200518
    # database  ncbi_nr

Regenerating the alignments against current databases is a reasonable thing to want, and the
pipeline supports it. **It has not been shown to produce a better model.** Two rebuilds bear on
this, one from a September 2026 UniRef90 search and one from the ColabFold MSA server, and
neither improved on the 2020 archive. Scores are averaged over the 34 CD-HIT clusters rather than
the 40 proteins, because several of the proteins are homologues of each other:

=========================================  =======  =============  ==============
set08 leave-one-out, ROC AUC per cluster   2020 nr  2026 UniRef90  2026 ColabFold
=========================================  =======  =============  ==============
mean                                       0.656    0.643          0.639
difference from nr                         --       -0.012         -0.017
95% confidence interval                    --       -0.034,+0.007  -0.049,+0.012
=========================================  =======  =============  ==============

Every interval contains zero, and ColabFold minus UniRef90 is -0.005 [-0.026, +0.016]. A failure
to reject is not proof of equivalence, so the honest statement is what the intervals exclude:
**any ColabFold advantage over UniRef90 above +0.016 AUC, or over nr above +0.012, is ruled out at
95%**, while an improvement below about 0.03 AUC would be too small for 40 proteins to detect.

Depth was then tested directly, with everything else held constant: the same server, the same
search, the same query and the same folds, differing only in whether the MMseqs2 diversity filter
runs. A **2.6x increase in total alignment depth moved ROC AUC by +0.0001**
[-0.016, +0.016]. That comparison carries no confound of time or algorithm, and it is the
clearest evidence that depth by itself is not the constraint. It does not show that no better
alignment exists -- a differently built or differently filtered one has not been tried.

The features that disagree most between alignment sources are the coevolution scores, and those
are among the features the model relies on most. ``DImax`` correlates at Spearman 0.45 between the
nr and UniRef90 feature sets and 0.26 between nr and ColabFold, against 1.00 for every
sequence-derived feature. A signal that can be rewritten that far without moving accuracy is
where the next accuracy work belongs -- starting with ``MI_highest_face``, which a review of this
comparison found to be a constant heptad mask rather than a coevolution feature at all. The full
analysis, including the limits of the comparison, is in ``docs/homologue_source_comparison.md``.

Two consequences worth keeping in mind:

* **Do not assume a refresh is an upgrade.** If you regenerate, re-run the validation and compare,
  rather than adopting the new model because its alignments are deeper.
* **Do not mix vintages.** A feature table with some proteins from 2020 nr and others from a
  current search is not a coherent dataset. Regenerate all of them or none.

``scripts/compare_blast_database_depth.py`` performs the comparison above between any two data
directories, and is how those numbers were produced. The full write-up, including a negative result
on protein language model embeddings, is in ``thoipapy/docs/embeddings_and_alignment_depth.rst``.


Where the data comes from
~~~~~~~~~~~~~~~~~~~~~~~~~

``dvc pull`` fetches from a publicly readable Cloudflare R2 bucket, declared in ``.dvc/config``.
It is read-only and anonymous by design: anyone can fetch the data, nobody can overwrite it.
Maintainers push with a separate credentialed remote configured in ``.dvc/config.local``, which is
not tracked by git.

The data originates from the dataset published with the paper, archived at the Open Science
Framework: https://osf.io/txjev/. The OSF archive is the citable record of what the paper used and
does not change. The DVC store is the working copy the pipeline reads, and it tracks the code.
Where the two differ, OSF is authoritative for the published results.

The protein sets
~~~~~~~~~~~~~~~~

``data/sets/`` holds the three protein sets published with the paper, matching
``data/protein_lists/`` in the `OSF repository <https://osf.io/txjev/>`_:

========================================  ===  =========================================
set                                       n    contents
========================================  ===  =========================================
``set05_ETRA_NMR_crystal_nr.csv``         50   all proteins, redundancy-reduced
``set07_test.csv``                        10   blind test set
``set08_train.csv``                       40   training set
========================================  ===  =========================================

set05 is the union of set07 and set08. The copies here carry a few extra annotation columns
beyond the OSF versions; the shared columns are identical.

These were Excel workbooks and are now CSV. They are single flat tables, so the workbook format
bought nothing and made them undiffable in git and awkward to read without Excel. The same applies
to ``data/protein_names.csv`` and the ETRA scanning-mutagenesis data in
``data/ETRA_data/Average_with_interface/``. Pipeline outputs under ``data/results/`` remain Excel
where a file genuinely holds several tables; the ones that did not are CSV.


Where homologues come from
---------------------------

**Recommended: retrieve homologues from the ColabFold MSA server.** Searching NCBI is no longer
viable for new work, and a local UniRef90 BLAST database is the fallback when the server is
unavailable or no third-party service is acceptable.

===================  ==========================================  =========================
source               use it for                                  cost
===================  ==========================================  =========================
**ColabFold**        **all new homologue retrieval**              none
UniRef90 local       when the MSA server is unavailable, or       96 GB, rebuilt per release
                     when nothing outside the machine may be
                     contacted
NCBI ``nr``          reading the archived 2020 alignments only    hours of queueing
===================  ==========================================  =========================

The three are indistinguishable on accuracy, so this is a recommendation about speed, disk and
availability rather than about prediction quality. See `Which homologue source should THOIPA use?
<docs/homologue_source_comparison.md>`_ for the measurements behind that.

**Why the shipped settings still say** ``homologue_source,ncbi``. That setting names the directory
the homologue csv files are read from and written to, and the DVC-tracked alignments that
reproduce the published results live in ``data/homologues/ncbi/``. Leaving the default alone is
what lets a fresh checkout reproduce those numbers. Change it to ``colabfold`` for any run that
retrieves new homologues; the pipeline refuses to start if the setting and the enabled stages
disagree, so the two cannot be mixed by accident.

Why this changed
~~~~~~~~~~~~~~~~

THOIPA was built in 2017-2020, when a BLAST query to NCBI returned in a few minutes. The sequence
databases have grown enormously since: ``nr`` now holds over a billion sequences, and NCBI queues
automated clients accordingly. A probe of a *three-residue* query in August 2026 returned
``RTOE=11165`` -- NCBI's own estimate of **3.1 hours** before results would be ready. A prediction
that took minutes when the paper was published can now take hours, or be refused outright if the
same client queries repeatedly.

That is not a fault in THOIPA and it is not something THOIPA can fix from the client side. NCBI
also does not archive old ``nr`` releases, so the May 2020 snapshot behind the published numbers
cannot be recovered by anyone. ``nr`` is the historical reference, not an option.

Retrieving homologues from the ColabFold MSA server
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

The server runs MMseqs2 with three profile iterations against UniRef30 and an environmental
database assembled from BFD, MGnify, MetaEuk and SMAG, then expands each matched cluster back to
its members. A search takes 10 to 70 seconds per protein against hours of NCBI queue, needs no
local database, and returns an archive containing ``msa.sh`` -- the exact command line and
database versions behind the alignment. The BLAST path recorded no equivalent.

.. code:: bash

    export THOIPA_COLABFOLD_CONTACT_EMAIL=you@example.com

Then switch ``homologue_source`` to ``colabfold`` in the settings CSV and enable the
``run_retrieve_homologues_from_colabfold`` and ``run_parse_colabfold_a3m_into_csv`` stages. They
replace the blastp search and the XML parse; everything downstream is unchanged, because the
homologue CSV they write carries the same columns.

The standalone predictor uses the same setting: ``run_THOIPA_prediction`` reads
``homologue_source`` from ``thoipapy/setting/standalone_run_settings.csv`` and takes the same
ColabFold path, so a single prediction no longer has to wait on an NCBI queue either.

A deployment selects its source with an environment variable instead of by editing a file inside
the installed package:

.. code:: bash

    export THOIPA_HOMOLOGUE_SOURCE=colabfold
    export THOIPA_COLABFOLD_CONTACT_EMAIL=you@example.com

``THOIPA_HOMOLOGUE_SOURCE`` overrides the settings file when set. ``THOIPA_COLABFOLD_CONTACT_EMAIL``
is required on that path and a prediction refuses to start without it, because the MSA server asks
automated clients to identify themselves. The shipped default remains ``ncbi``, so an upgrade does
not change what an existing installation returns.

Licensing and attribution
~~~~~~~~~~~~~~~~~~~~~~~~~~

Nothing here restricts commercial use. ColabFold and MMseqs2 are MIT licensed, and the databases
distributed at `colabfold.mmseqs.com <https://colabfold.mmseqs.com>`_ state that "all files are
available under a Creative Commons Attribution 4.0 International (CC BY 4.0) License". UniProt,
from which UniRef30 derives, is also CC BY 4.0. All of these permit commercial use provided the
sources are attributed, which means citing ColabFold, MMseqs2 and the databases in anything
published from THOIPA output.

The public server publishes no terms of service, and the constraint on it is a fair-use
expectation rather than a licence: the compute is donated by KOBIC and the Söding Lab, the
operators describe it as a limited shared resource, and they reserve the right to limit access
case by case. Treat it as a courtesy that can be withdrawn rather than a service with a guarantee,
and keep the self-hosting route below available for anything that outgrows it.

``api.colabfold.com`` is a free academic service that processes a few thousand alignments a day
and asks for serial queries from a single IP. A 40-protein set is three orders of magnitude inside
that, and this webserver's traffic has never come near it, so the public server is the default
rather than a stopgap. THOIPA submits one protein at a time and never searches in parallel. A
deployment with steady traffic should host its own MMseqs2 server and point
``THOIPA_COLABFOLD_HOST`` at it; nothing else changes. Self-hosting is not a way to save the disk,
though: the two ColabFold databases are 103 GB and 118 GB as downloads, and ColabFold's own setup
guidance puts them nearer 1 TB once built with indexes, against 96 GB for the local UniRef90
BLAST database. Self-hosting buys independence from a shared service, and costs roughly an order
of magnitude more disk than the thing it replaces.

Fallback: a local UniRef90 BLAST database
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

Use this if the MSA server is unavailable, or if you need the pipeline to run with no third-party
service in the path at all. It costs about 96 GB of disk and a rebuild every UniProt release, and
it is indistinguishable from ColabFold on accuracy (-0.005 ROC AUC, see above), so the disk buys
availability rather than quality.

**Either way this is a breaking change: predictions will not match the published results.** A
different database yields a different homologue set, a different alignment, and therefore
different conservation, coevolution and polarity features. The scores move.

Setting up UniRef90
~~~~~~~~~~~~~~~~~~~

UniRef90 clusters UniProt at 90% identity: 121 million clusters against ``nr``'s billion-plus
sequences, with little practical loss for this pipeline, which collapses exact-duplicate TMD
sequences and runs CD-HIT anyway.

Requirements: about **160 GB of free disk** and BLAST+. The script keeps the 32 GB download, the
decompressed FASTA and the built database side by side, and deletes none of them, so peak usage is
all three at once.

::

    mamba install -c bioconda blast

    # Downloads UniRef90 and runs makeblastdb. Idempotent: an existing download is not refetched.
    # Expect several hours for the download and 1-2 hours to build.
    python scripts/build_local_blast_db.py

    export THOIPA_LOCAL_BLAST_DB=/mnt/shared/blastdb/uniref90

Or by hand::

    wget https://ftp.uniprot.org/pub/databases/uniprot/uniref/uniref90/uniref90.fasta.gz
    gunzip uniref90.fasta.gz
    makeblastdb -in uniref90.fasta -dbtype prot -out uniref90 -title uniref90 -parse_seqids

With ``THOIPA_LOCAL_BLAST_DB`` set, predictions search that database. Unset, they fall back to
querying NCBI, which requires ``THOIPA_NCBI_CONTACT_EMAIL`` because NCBI expects automated
clients to identify themselves. That path is kept for reproducing old runs and is not
recommended for new ones: see the queueing times above.

A smaller database for tests
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

Set ``DATABASE_TO_BUILD = "swissprot"`` in the script for a 575k-sequence, ~340 MB database that
builds in ten seconds and answers in under one. Use it for tests, CI and development.

**Do not use Swiss-Prot for production.** It yields roughly a quarter of ``nr``'s alignment depth:
26 hits against 76 unique TMD homologues for ``1xioA4``, 18 against 101 for ``4hksA1``, and only 10
survived filtering for glycophorin A. Conservation, rate4site and coevolution rank 4th, 2nd and 6th
by mean decrease in impurity, and all derive from that alignment.

A note on database choice
~~~~~~~~~~~~~~~~~~~~~~~~~

A database filtered to membrane proteins does **not** help. THOIPA needs homologues of the query
protein itself -- glycophorin A's useful hits are glycophorins in other species -- so what matters
is taxonomic depth within the query's own family, not enrichment for membrane proteins. Filtering
on a transmembrane annotation would also silently drop genuine homologues that merely lack the
annotation, and alignment depth is precisely what must not be lost.

NCBI does not host UniRef90, so the remote BLAST path cannot use it. NCBI's BLAST service offers
``nr``, ``refseq_protein``, ``swissprot``, ``pdb``, ``env_nr``, ``tsa_nr``, ``landmark`` and
``pataa``; of those only ``nr`` has comparable depth, and it is the one that queues for hours.
This is why the homologue search moved to the ColabFold MSA server rather than to another NCBI
database.


Reproducing the published results
---------------------------------

Versions from 2.0.0 onwards include corrections and improvements made after publication, so their
output differs slightly from the numbers in the 2020 paper. The differences are small and do not
change the conclusions, but they are real.

**To reproduce the results as published**, use the state of the repository at the time of
publication rather than the current release:

* thoipapy **v1.2.0**, git tag ``1.2.0`` (commit ``67a1438``)
* the dataset published via the `Open Science Foundation <https://osf.io/txjev/>`_

Note that v1.2.0 requires python 3.8 and the dependency versions pinned in its ``requirements.txt``;
it will not run on a current scientific python stack.

**For any new work**, use the current release. The main post-publication corrections are that
feature selection is now deterministic (it previously depended on the interpreter's hash seed, so
the selected feature set varied between runs), model training and hyperparameter tuning are seeded,
and several ineffective filters and dead assertions were repaired.


Usage as a standalone predictor
-------------------------------

* for local predictions on linux, first install NCBI_BLAST, biopython, freecontact, CD-HIT and rate4site
* see ``test/functional/test_standalone_prediction.py`` for the current run syntax, typically

.. code:: python

    from thoipapy import run_THOIPA_prediction
    from thoipapy.predict import get_md5_checksum
    from thoipapy.utils import make_sure_path_exists

    protein_name = "ERBB3"
    TMD_seq = "MALTVIAGLVVIFMMLGGTFL"
    full_seq = "MVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLA"
    out_dir = "/path/to/your/desired/output/folder"
    make_sure_path_exists(out_dir)
    md5 = get_md5_checksum(TMD_seq, full_seq)
    run_THOIPA_prediction(protein_name, md5, TMD_seq, full_seq, out_dir)


**Example Output**

* the output includes a csv showing the THOIPA prediction for each residue, as well as a heatmap figure as a summary
* below is a heatmap showing the THOIPA prediction, and underlying conservation, relative polarity, and coevolution

.. image:: https://raw.githubusercontent.com/bojigu/thoipapy/develop/thoipapy/docs/standalone_heatmap_example.png


Create your own machine learning predictor
------------------------------------------

* THOIPA can be retrained to any dataset of your choice
* the original set of training sequences and other resources are published via the `Open Science Foundation <https://osf.io/txjev/>`_, and are also what ``dvc pull`` fetches into ``data/``
* the THOIPA feature extraction, feature selection, and training pipeline is fully automated
* `open an issue <https://github.com/bojigu/thoipapy/issues>`__ for an introduction to the THOIPA software pipeline and settings

The data, sets and base directories are resolved from the repository itself (see
``thoipapy/paths.py``); they are no longer read from the settings spreadsheet. Protein sets are
defined in ``data/sets/``. Because the training data is not shipped inside the installed package,
the training pipeline can only be run from a checkout of this repository, not from
``pip install thoipapy``.


Where things are
----------------

============================================  ==========================================
path                                          contents
============================================  ==========================================
``thoipapy/predict.py``                       standalone prediction for a single sequence
``thoipapy/run.py``                           the training and validation pipeline
``thoipapy/features/``                        one module per feature
``thoipapy/homologues/``                      BLAST search and alignment parsing
``thoipapy/ML_model/``                        training, tuning, and the shipped model
``thoipapy/validation/``                      cross-validation and performance metrics
``thoipapy/paths.py``                         resolves ``data/``, ``data/sets/`` and settings
``thoipapy/artefacts.py``                     ``ArtefactPaths``: the path of every pipeline file
``thoipapy/run_settings.py``                  ``RunSettings``: which pipeline stages run
``thoipapy/paper_figures/``                   2020 paper figures; ``create_BOcurve_files`` is live
============================================  ==========================================

Settings are CSV. ``thoipapy/setting/run_settings_example.csv`` drives a training run,
``standalone_run_settings.csv`` a single prediction, and ``model_features.csv`` lists the features
eligible for the model. Each row of the two run-settings files carries a ``type`` column and is
converted on load.

Pipeline functions take explicit named parameters rather than a settings dictionary, so a
signature states what the function reads::

    def lipo_from_pssm_mult_prot(paths, df_set, lipophilicity_scale, logging):

Artefact filenames encode the settings that produced them (``surr20.gaps5``). ``ArtefactPaths``
computes them, so writers and readers cannot disagree when a setting changes.

Run the training pipeline with::

    python -m thoipapy.run

The settings path is hardcoded in ``run.py``. To use a different one, import ``run()`` and pass
your own settings dict.


License
-------

THOIPApy is free software distributed under the permissive MIT License.


Contribute
-------------

* Contributors are welcome.
* For bug reports, questions and feature requests, please `open an issue <https://github.com/bojigu/thoipapy/issues>`__.


Contact
-------

THOIPA is maintained by Mark Teese. To make contact, `open an issue <https://github.com/bojigu/thoipapy/issues>`__ or use `LinkedIn <https://www.linkedin.com/in/markteese/>`_.

* Mark Teese, `22DataCatalysis GmbH <https://www.datacatalysis.com>`_, formerly of the Langosch Lab at the `Technical University of Munich <https://www.tum.de/en/>`_
* Bo Zeng, `Chinese Academy of Sciences, Beijing <http://english.cas.cn/>`_, formerly of the Frishman Lab at the `Technical University of Munich <https://www.tum.de/en/>`_


Citation
--------

`Yao Xiao, Bo Zeng, Nicola Berner, Dmitrij Frishman, Dieter Langosch, and Mark George Teese (2020)
Experimental determination and data-driven prediction of homotypic transmembrane domain interfaces,
Computational and Structural Biotechnology Journal <https://doi.org/10.1016/j.csbj.2020.09.035>`_
